PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011575.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 252aa    MW: 26375.5 Da    PI: 7.2107
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011575.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.4e-3849106461
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 +  +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +s
  Do011575.1  49 EGDPCPRCESRDTKFCYYNNYNTSQPRHFCKGCRRYWTKGGTLRNVPVGGGTRKKPSS 106
                 6789**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2549100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.42551105IPR003851Zinc finger, Dof-type
PfamPF027016.8E-3252103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MQEVAAEPGR GRAAQQQQFA GVDLRRPKGY AAPVVSQAAT AARAATPAEG DPCPRCESRD  60
TKFCYYNNYN TSQPRHFCKG CRRYWTKGGT LRNVPVGGGT RKKPSSSPSA YAAAANADKP  120
KKPSKKKRRV VVAAQDQEPA AAADTVVAAA PAADSAKTAK IETATPTTTD PASEITTEIV  180
VPAAAEEEDS LAHLLQPDVA LGLGISDFSA GKGLDVLEPD SFEWPAAFDL GTCWGSAGFA  240
DPDPAGLFLN LP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124128KKKRR
2124129KKKRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9658592e-80EU965859.1 Zea mays clone 289437 dof zinc finger protein MNB1A mRNA, complete cds.
GenBankEU9693882e-80EU969388.1 Zea mays clone 329608 dof zinc finger protein MNB1A mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973764.11e-104PREDICTED: dof zinc finger protein MNB1A-like
SwissprotP385641e-78MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A0A9RZJ13e-89A0A0A9RZJ1_ARUDO; Dof1
STRINGSb07g028850.18e-84(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-27DOF zinc finger protein 1